Invitrogen™ Human ACP6 (aa 223-301) Control Fragment Recombinant Protein

Product Code. 30196858

Brand: Invitrogen™ RP94413

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55900 (PA5-55900. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lysophosphatidic acid phosphatase type 6 (ACP6), also designated acid phosphatase-like protein 1 (ACPL1) or lysophosphatidic acid phosphatase (LPAP), is a 428 amino acid secreted protein that hydrolyzes lysophosphatidic acid to monoacylglycerol. ACP6 is highly expressed in kidney, heart, small intestine, muscle, liver, prostate, testis, ovary and exists as two isoforms as a result of alternative splicing events. The gene encoding ACP6 maps to human chromosome 1, the largest human chromosome spanning about 260 million base pairs and making up 8% of the human genome. Notably, the rare aging disease Hutchinson-Gilford progeria is associated with the LMNA gene of human chromosome 1, which encodes lamin A. Stickler syndrome, Parkinsons, Gaucher disease, familial adenomatous polyposis and Usher syndrome are also associated with chromosome 1. Aberrations in chromosome 1 are found in a variety of cancers including head and neck cancer, malignant melanoma and multiple myeloma.

Specifications

• Accession Number: Q9NPH0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51205
• Name: Human ACP6 (aa 223-301) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3.1.3.2; 5730559A09Rik; Acid phosphatase 6, lysophosphatidic; acid phosphatase like 1; acid phosphatase-like protein 1; Acp6; Acpl1; AU022842; Lpap; Lysophosphatidic acid phosphatase type 6; mPACPL1; PACPL1; UNQ205/PRO231
• Common Name: ACP6
• Gene Symbol: ACP6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SLQPGISEDLKKVKDRMGIDSSDKVDFFILLDNVAAEQAHNLPSCPMLKRFARMIEQRAVDTSLYILPKEDRESLQMAV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining