Invitrogen™ Human ACOXL (aa 360-451) Control Fragment Recombinant Protein

Product Code. 30194356

Brand: Invitrogen™ RP96146

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57257 (PA5-57257. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ACOXL gene ontology annotations related to this gene include fatty acid beta-oxidation.

Specifications

• Accession Number: Q9NUZ1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55289
• Name: Human ACOXL (aa 360-451) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ACOXL; acyl-CoA oxidase like; acyl-CoA oxidase-like; acyl-CoA oxidase-like protein; acyl-Coenzyme A oxidase-like; acyl-coenzyme A oxidase-like protein; acyl-coenzyme A oxidase-like protein-like
• Common Name: ACOXL
• Gene Symbol: ACOXL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RISGLKCDTDVFATFEGDDVVMLQVVGRELLAQYTKQYEEKPLFGLLQNWAESVGDKLRTSFLAFNMDTVDDLAFLLKAVKFRERVLQRGLV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining