missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ACOT7 (aa 9-98) Control Fragment Recombinant Protein

Product Code. 30211640
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211640

Brand: Invitrogen™ RP94055

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55251 (PA5-55251. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the acyl coenzyme family. The encoded protein hydrolyzes the CoA thioester of palmitoyl-CoA and other long-chain fatty acids. Decreased expression of this gene may be associated with mesial temporal lobe epilepsy. Alternatively spliced transcript variants encoding distinct isoforms with different subcellular locations have been characterized.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O00154
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11332
Name Human ACOT7 (aa 9-98) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2410041A17Rik; 50-kDa brain acyl-CoA hydrolase; ACH1; Acot7; ACT; acyl-CoA thioesterase 2; acyl-CoA thioesterase 7; acyl-CoA thioesterase, long chain; Bach; brain acyl CoA hydrolase; brain acyl-CoA hydrolase; CTE-II; CTE-IIa; CTE-IIb; cytosolic acyl coenzyme A thioester hydrolase; hBACH; L RP1-120G22.10; LACH; LACH1; Long chain acyl-CoA thioester hydrolase; MTE-II
Common Name ACOT7
Gene Symbol ACOT7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITGRIMRPDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.