Invitrogen™ Human ACOT2 (aa 1-62) Control Fragment Recombinant Protein

Product Code. 30209842

Brand: Invitrogen™ RP108217

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84443 (PA5-84443. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acyl-CoA thioesterases (ACOTs) are a group of enzymes that catalyze the hydrolysis of acyl-CoA to form coenzyme A (CoA) and a free fatty acid. Through their catalytic activity, ACOTs are able to regulate the level of fatty acids and acyl-CoAs within the cell. ACOT1 (acyl-CoA thioesterase 1, also known as CTE1) and ACOT2 (acyl-CoA thioesterase 2, also known as PTE2) are members of the ACOT family and exhibit different cellular localization, with ACOT1 existing as a monomer in the cytoplasm and ACOT2 localized primarily to mitochondria. Characteristic of most ACOT proteins, ACOT1 and ACOT2 catalyze the conversion of Palmitoyl-CoA and water to free CoA and palmitate, a reaction that is important for the regulation of intercellular fatty acid levels. ACOT2 is expressed as multiple alternatively spliced isoforms and, like ACOT1, is encoded by a gene which maps to human chromosome 14.

Specifications

• Accession Number: P49753
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10965
• Name: Human ACOT2 (aa 1-62) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA571646; Acot2; Acyl coenzyme A thioester hydrolase; acyl-CoA thioesterase 2; Acyl-coenzyme A thioester hydrolase 2 A; acyl-coenzyme A thioesterase 2, mitochondrial; ARTISt/p43; CTE Ia; CTE1A; CTE-Ia; long-chain acyl-CoA thioesterase 2; mitochondrial acyl-CoA thioesterase 1; Mte1; MTE-I; peroxisomal long-chain acyl-coA thioesterase 2; PTE2; PTE2A; Very-long-chain acyl-CoA thioesterase; ZAP128
• Common Name: ACOT2
• Gene Symbol: ACOT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MSNKLLSPHPHSVVLRSEFKMASSPAVLRASRLYQWSLKSSAQFLGSPQLRQVGQIIRVPAR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining