missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ACOT2 (aa 1-62) Control Fragment Recombinant Protein

Product Code. 30209842
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30209842 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30209842 Supplier Invitrogen™ Supplier No. RP108217

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84443 (PA5-84443. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acyl-CoA thioesterases (ACOTs) are a group of enzymes that catalyze the hydrolysis of acyl-CoA to form coenzyme A (CoA) and a free fatty acid. Through their catalytic activity, ACOTs are able to regulate the level of fatty acids and acyl-CoAs within the cell. ACOT1 (acyl-CoA thioesterase 1, also known as CTE1) and ACOT2 (acyl-CoA thioesterase 2, also known as PTE2) are members of the ACOT family and exhibit different cellular localization, with ACOT1 existing as a monomer in the cytoplasm and ACOT2 localized primarily to mitochondria. Characteristic of most ACOT proteins, ACOT1 and ACOT2 catalyze the conversion of Palmitoyl-CoA and water to free CoA and palmitate, a reaction that is important for the regulation of intercellular fatty acid levels. ACOT2 is expressed as multiple alternatively spliced isoforms and, like ACOT1, is encoded by a gene which maps to human chromosome 14.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P49753
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10965
Name Human ACOT2 (aa 1-62) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA571646; Acot2; Acyl coenzyme A thioester hydrolase; acyl-CoA thioesterase 2; Acyl-coenzyme A thioester hydrolase 2 A; acyl-coenzyme A thioesterase 2, mitochondrial; ARTISt/p43; CTE Ia; CTE1A; CTE-Ia; long-chain acyl-CoA thioesterase 2; mitochondrial acyl-CoA thioesterase 1; Mte1; MTE-I; peroxisomal long-chain acyl-coA thioesterase 2; PTE2; PTE2A; Very-long-chain acyl-CoA thioesterase; ZAP128
Common Name ACOT2
Gene Symbol ACOT2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MSNKLLSPHPHSVVLRSEFKMASSPAVLRASRLYQWSLKSSAQFLGSPQLRQVGQIIRVPAR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.