Invitrogen™ Human ACOT1 (aa 267-330) Control Fragment Recombinant Protein

Product Code. 30203907

Brand: Invitrogen™ RP104360

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60475 (PA5-60475. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Active towards fatty acyl-CoA with chain-lengths of C12-C16. Hunt M.C., Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases. Li W.B., Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases.

Specifications

• Accession Number: Q86TX2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 641371
• Name: Human ACOT1 (aa 267-330) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ACH2; ACOT1; Acyl-CoA thioesterase 1; acyl-coenzyme A thioesterase 1; CTE1; CTE-1; CTE-I; CTE-Ib; Inducible cytosolic acyl-coenzyme A thioester hydrolase; L CTE-I; LACH2; Long chain acyl-CoA hydrolase; long chain acyl-CoA thioester hydrolase; Palmitoyl-coenzyme A thioesterase
• Common Name: ACOT1
• Gene Symbol: ACOT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YKGETLPPVGVNRNRIKVTKDGYADIVDVLNSPLEGPDQKSFIPVERAESTFLFLVGQDDHNWK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining