Invitrogen™ Human ACK1 (aa 137-207) Control Fragment Recombinant Protein

Product Code. 30195324

Brand: Invitrogen™ RP97242

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111144 (PA5-111144. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TNK2 (ACK) (activated Cdc42-associated kinase) is a non-receptor tyrosine kinase that signals downstream of Cdc42. TNK2 is known to be involved in tumorigenesis and metastasis, particularly in prostate cancer. Downstream effector of CDC42 which mediates CDC42-dependent cell migration via phosphorylation of BCAR1. May be involved both in adult synaptic function and plasticity and in brain development. Activates AKT1 by phosphorylating it on 'Tyr-176'. Phosphorylates AR on 'Tyr-267' and 'Tyr-363' thereby promoting its recruitment to androgen-responsive enhancers (AREs). Phosphorylates WWOX on 'Tyr-287'. Phosphorylates MCF2, thereby enhancing its activity as a guanine nucleotide exchange factor (GEF) toward Rho family proteins. Contributes to the control of AXL receptor levels. Confers metastatic properties on cancer cells and promotes tumor growth by negatively regulating tumor suppressor such as WWOX and positively regulating pro-survival factors such as AKT1 and AR. Phosphorylates WASP.

Specifications

• Accession Number: Q07912
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10188
• Name: Human ACK1 (aa 137-207) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ACK; ACK1; Ack-1; Activated CDC42 kinase 1; activated Cdc42-associated kinase 1; activated p21cdc42Hs kinase; Cdc42 GTPase-inhibiting protein; Cdgip; Non-receptor protein tyrosine kinase Ack; p21cdc42Hs; P21cdc42Hs kinase; Pyk1; Tnk2; tnk2 {ECO:0000250; tyrosine kinase non receptor 2; tyrosine kinase non-receptor protein 2; tyrosine kinase, non-receptor, 2; UniProtKB:Q07912}
• Common Name: ACK1
• Gene Symbol: TNK2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining