Invitrogen™ Human ACCSL (aa 87-175) Control Fragment Recombinant Protein

Product Code. 30196602

Brand: Invitrogen™ RP109078

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139872 (PA5-139872. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ACCSL gene ontology annotations related to this gene include biosynthetic process.

Specifications

• Accession Number: Q4AC99
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 390110
• Name: Human ACCSL (aa 87-175) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1-aminocyclopropane-1-carboxylate synthase (inactive)-like; 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional)-like; 1-aminocyclopropane-1-carboxylate synthase homolog (inactive) like; 1-aminocyclopropane-1-carboxylate synthase-like protein 2; ACC synthase-like protein 2; ACCSL; Probable inactive 1-aminocyclopropane-1-carboxylate synthase-like protein 2
• Common Name: ACCSL
• Gene Symbol: ACCSL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASGLELQVPLPSEDSRGDVRYGQRAQLSGQPDPVPQLSDCEAAFVNRDLSIRGIDISVFYQSSFQDYNAYQKDKYHKDKNTLGFINLGT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining