missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ACAP2 (aa 477-548) Control Fragment Recombinant Protein

Product Code. 30195665
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195665

Brand: Invitrogen™ RP96298

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57068 (PA5-57068. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ACAP2 is a transport carrier belonging to the Centaurin family with three ANK repeats, an Arf-GAP domain, a BAR domain, and a PH domain. ACAP2, a GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6) has robust constitutive ARF6 GAP activity, where the GAP activity is stimulated by phosphatidylinositol 4,5-bisphosphate (PIP2) and phosphatidic acid but has little activity toward ARF1 and is known to control the return of ARF to the inactive GDB-bound shots. ACAP2, along with ACAP1, is targeted by phosphatidyl inositol (3, 4, 3) triphosphate inhibiting the formation of PDGF-induced dorsal membrane ruffles in NIH3T3 fibroblasts when overexpressed. ACAP2 is phosphorylated upon DNA damage, probably by ATM or ATR. Expression is wide-spread with the highest level in lung.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q15057
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23527
Name Human ACAP2 (aa 477-548) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4832442G16; 9530039J15Rik; ACAP2; Arf GAP with coiled coil, ANK repeat and PH domains 2; arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2; ArfGAP with coiled-coil, ankyrin repeat and PH domains 2; centaurin beta2; centaurin, beta 2; centaurin-beta-2; Centb2; CNT-B2; KIAA0041; mKIAA0041
Common Name ACAP2
Gene Symbol ACAP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.