Invitrogen™ Human ACAP2 (aa 477-548) Control Fragment Recombinant Protein

Product Code. 30195665

Brand: Invitrogen™ RP96298

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57068 (PA5-57068. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ACAP2 is a transport carrier belonging to the Centaurin family with three ANK repeats, an Arf-GAP domain, a BAR domain, and a PH domain. ACAP2, a GTPase-activating protein (GAP) for ADP ribosylation factor 6 (ARF6) has robust constitutive ARF6 GAP activity, where the GAP activity is stimulated by phosphatidylinositol 4,5-bisphosphate (PIP2) and phosphatidic acid but has little activity toward ARF1 and is known to control the return of ARF to the inactive GDB-bound shots. ACAP2, along with ACAP1, is targeted by phosphatidyl inositol (3, 4, 3) triphosphate inhibiting the formation of PDGF-induced dorsal membrane ruffles in NIH3T3 fibroblasts when overexpressed. ACAP2 is phosphorylated upon DNA damage, probably by ATM or ATR. Expression is wide-spread with the highest level in lung.

Specifications

• Accession Number: Q15057
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23527
• Name: Human ACAP2 (aa 477-548) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4832442G16; 9530039J15Rik; ACAP2; Arf GAP with coiled coil, ANK repeat and PH domains 2; arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2; ArfGAP with coiled-coil, ankyrin repeat and PH domains 2; centaurin beta2; centaurin, beta 2; centaurin-beta-2; Centb2; CNT-B2; KIAA0041; mKIAA0041
• Common Name: ACAP2
• Gene Symbol: ACAP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining