Invitrogen™ Human ACAD8 (aa 227-323) Control Fragment Recombinant Protein

Product Code. 30206320

Brand: Invitrogen™ RP97417

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60547 (PA5-60547. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. The encoded protein is a mitochondrial enzyme that functions in catabolism of the branched-chain amino acid valine. Defects in this gene are the cause of isobutyryl-CoA dehydrogenase deficiency.

Specifications

• Accession Number: Q9UKU7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27034
• Name: Human ACAD8 (aa 227-323) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310016C19Rik; Acad8; ACAD-8; Activator-recruited cofactor 42 kDa component; acyl-CoA dehydrogenase family member 8; acyl-CoA dehydrogenase family, member 8; acyl-Coenzyme A dehydrogenase family, member 8; AI786953; ARC42; IBD; IBDH; Isobutyryl-CoA dehydrogenase, mitochondrial; RGD1564209
• Common Name: ACAD8
• Gene Symbol: ACAD8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining