Invitrogen™ Human ACAA1 (aa 273-328) Control Fragment Recombinant Protein

Product Code. 30196054

Brand: Invitrogen™ RP88950

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82262 (PA5-82262. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: P09110
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 30
• Name: Human ACAA1 (aa 273-328) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3-ketoacyl-CoA thiolase A, peroxisomal; 3-ketoacyl-CoA thiolase B, peroxisomal; 3-ketoacyl-CoA thiolase, peroxisomal; ACAA; ACAA1; Acaa1a; Acaa1b; Acetyl-CoA acyltransferase; acetyl-CoA acyltransferase 1; acetyl-CoA acyltransferase 1 A; acetyl-CoA acyltransferase 3-oxo acyl-CoA thiolase A 1 peroxisomal; Acetyl-CoA acyltransferase 3-oxo acyl-CoA thiolase A peroxisomal; acetyl-CoA acyltransferase A; Acetyl-CoA acyltransferase B; acetyl-CoA acyltransferase, 3-oxo acyl-CoA thiolase A; acetyl-Coenzyme A acyltransferase 1; acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme A thiolase); acetyl-Coenzyme A acyltransferase 1 A; acetyl-Coenzyme A acyltransferase 1 B; beta-ketothiolase; Beta-ketothiolase A; beta-ketothiolase B; D9Ertd25e; peroxisomal 3-ketoacyl-CoA thiolase; peroxisomal 3-ketoacyl-CoA thiolase B; peroxisomal 3-oxoacyl-CoA thiolase; Peroxisomal 3-oxoacyl-CoA thiolase A; peroxisomal 3-oxoacyl-CoA thiolase B; peroxisomal 3-oxoacyl-Coenzyme A thiolase; Pktaa; PTHIO; PTL; RGD1562373; testicular tissue protein Li 197; THIO; thiolase A; thiolase B
• Common Name: ACAA1
• Gene Symbol: ACAA1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining