Invitrogen™ Human ABRA1 Control Fragment Recombinant Protein

Product Code. 30202045

Brand: Invitrogen™ RP102777

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58042 (PA5-58042. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CCDC98, also known as Abraxas 1, was identified through protein binding studies using the breast and ovarian predisposition protein BRCA1 as the binding target. CCDC98 recruits RAP80, a ubiquitin-binding protein, to BRCA1, allowing the formation of BRCA1 foci in response to DNA damage caused by ionizing radiation. Both CCDC98 and RAP80 are required for DNA damage resistance, G2-M checkpoint control, and DNA repair. Cells depleted of either CCDC98 or RAP80 exhibited increased sensitivity to ionizing radiation, although not as much as in BRCA1-depleted cells, suggesting that CCDC98 and RAP80 control only part of the DNA damage response role of BRCA1. At least two isoforms of CCDC98 are known to exist.

Specifications

• Accession Number: Q6UWZ7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84142
• Name: Human ABRA1 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3830405G04Rik; 5630400M01Rik; ABRA1; abraxas protein; Abraxas1; AI506069; AL024423; AV118690; BRCA1-A complex subunit Abraxas; BRCA1-A complex subunit Abraxas 1; Ccdc98; coiled-coil domain containing 98; coiled-coil domain-containing protein 98; FAM175A; family with sequence similarity 175 member A; family with sequence similarity 175, member A; FLJ11520; FLJ12642; FLJ13614; Protein FAM175A; RGD1305287; UNQ496/PRO1013
• Common Name: ABRA1
• Gene Symbol: Abraxas1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CNYNHHLDVVDNLTLMVEHTDIPEASPASTPQIIKHKTLDLDDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFGEYSRSPT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining