Invitrogen™ Human ABI3 (aa 62-163) Control Fragment Recombinant Protein

Product Code. 30199119

Brand: Invitrogen™ RP90723

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53592 (PA5-53592. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Inhibits ectopic tumor cell metastasis of SRD cells. In vitro, reduces cell motility.

Specifications

• Accession Number: Q9P2A4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51225
• Name: Human ABI3 (aa 62-163) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2210414K06Rik; ABI family member 3; ABI family, member 3; ABI gene family member 3; ABI gene family, member 3; Abi3; AI987680; NESH; NESH protein; new molecule including SH3; SSH3BP3
• Common Name: ABI3
• Gene Symbol: ABI3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AYQVGNLAGHTLRMLDLQGAALRQVEARVSTLGQMVNMHMEKVARREIGTLATVQRLPPGQKVIAPENLPPLTPYCRRPLNFGCLDDIGHGIKDLSTQLSRT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining