Invitrogen™ Human ABHD9 (aa 259-360) Control Fragment Recombinant Protein

Product Code. 30203423

Brand: Invitrogen™ RP90050

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52992 (PA5-52992. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The alpha/beta hydrolase superfamily comprise diverse members that are involved in important biochemical processes and related to various diseases. They have unrelated sequences, various substrates, and different kinds of catalytic activities, yet they share the same canonical alpha/beta hydrolase fold, which consists of an eight stranded parallel alpha/beta structure. They are also characterized by a catalytic triad composed of a histidine, an acid and a nucleophile. Members of this superfamily are often drug targets for treating diseases, such as diabetes, Alzheimer's disease, obesity and blood clotting disorders. The abhydrolase domain-containing protein 9 (ABHD9), also designated epoxide hydrolase 3 (EPHX3), is a 360 amino acid protein and a member of the alpha/beta hydrolase superfamily. The gene encoding ABHD9 maps to chromosome 19, which consists of over 63 million bases, houses approximately 1,400 genes and is recognized for having the greatest gene density of the human chromosomes.

Specifications

• Accession Number: Q9H6B9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79852
• Name: Human ABHD9 (aa 259-360) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310063B19Rik; Abhd9; abhydrolase domain containing 9; abhydrolase domain-containing protein 9; EH3; Ephx3; Epoxide hydrolase 3
• Common Name: ABHD9
• Gene Symbol: EPHX3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SELEAFLYNFSQPGGLTGPLNYYRNLFRNFPLEPQELTTPTLLLWGEKDTYLELGLVEAIGSRFVPGRLEAHILPGIGHWIPQSNPQEMHQYMWAFLQDLLD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining