missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ABHD8 (aa 316-408) Control Fragment Recombinant Protein

Product Code. 30201968
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201968

Brand: Invitrogen™ RP95836

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58044 (PA5-58044. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The alpha/beta hydrolase superfamily comprise diverse members that are involved in important biochemical processes and related to various diseases. They have unrelated sequences, various substrates, and different kinds of catalytic activities, yet they share the same canonical alpha/beta hydrolase fold, which consists of an eight-stranded parallel alpha/beta structure. They are also characterized by a catalytic triad composed of a histidine, an acid and a nucleophile. Members of this superfamily are often drug targets for treating diseases, such as diabetes, Alzheimer's disease, obesity and blood clotting disorders. The alpha/beta hydrolase domain containing (ABHD) gene subfamily is comprised of 15 mostly uncharacterized members, most of which utilize a serine nucleophile to form the G-X-S-X-G nucleophile elbow. ABHD8 is a 439 amino acid protein that belongs to the AB hydrolase superfamily.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96I13
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79575
Name Human ABHD8 (aa 316-408) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0910001L24Rik; AB030191; ABHD8; abhydrolase domain containing 8; abhydrolase domain-containing protein 8; Alpha/beta hydrolase domain-containing protein 8; protein ABHD8
Common Name ABHD8
Gene Symbol ABHD8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIDEGSHMVMLECPETV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.