Invitrogen™ Human ABHD16B (aa 358-428) Control Fragment Recombinant Protein

Product Code. 30180924

Brand: Invitrogen™ RP99460

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63696 (PA5-63696. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q9H3Z7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 140701
• Name: Human ABHD16B (aa 358-428) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ABHD16B; abhydrolase domain containing 16 B; abhydrolase domain-containing protein 16 B; Alpha/beta hydrolase domain-containing protein 16 B; C20orf135; dJ591C20.1; protein ABHD16B
• Common Name: ABHD16B
• Gene Symbol: ABHD16B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VVMAREGRAVVTRWLRAGSLAQEAAFYARYRVDEDWCLALLRSYRARCEEELEGEEALGPHGPAFPWLVGQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining