Invitrogen™ Human ABHD15 Control Fragment Recombinant Protein

Product Code. 30200672

Brand: Invitrogen™ RP90423

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53174 (PA5-53174. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ABHD15 gene ontology annotations related to this gene include cellular lipid metabolic process.

Specifications

• Accession Number: Q6UXT9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 116236
• Name: Human ABHD15 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300007F04Rik; ABHD15; abhydrolase domain containing 15; abhydrolase domain-containing protein 15; abhydrolase domain-containing protein 15; protein ABHD15; alpha/beta hydrolase; alpha/beta hydrolase domain-containing protein 15; alpha/beta hydrolase-1; lung alpha/beta hydrolase 1; protein ABHD15; RGD1304598; UNQ6510/PRO21435
• Common Name: ABHD15
• Gene Symbol: ABHD15
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TALEDTVDTSRLFRSRSLREFEEALFCHTKSFPISWDAYWDRNDPLRDVDEAAVPVLCICSADDPVCGPPDHTLTTELFHSNPYFFLLLSRHGGHCGFLRQEPLPAWSHEVILESFRALTEFFRTEERIKGLSR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining