Invitrogen™ Human ABHD13 (aa 235-320) Control Fragment Recombinant Protein

Product Code. 30203334

Brand: Invitrogen™ RP102618

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56943 (PA5-56943. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The α/β hydrolase superfamily comprise diverse members that are involved in important biochemical processes and related to various diseases. They have unrelated sequences, various substrates, and different kinds of catalytic activities, yet they share the same canonical α/β hydrolase fold, which consists of an eightstranded parallel α/β structure. They are also characterized by a catalytic triad composed of a histidine, an acid and a nucleophile. Members of this superfamily are often drug targets for treating diseases, such as diabetes, Alzheimer's disease, obesity and blood clotting disorders. The Ab hydrolase domain containing (ABHD) gene subfamily is comprised of 15 mostly uncharacterized members. Most of which utilize a serine nucleophile to form the G-X-S-X-G nucleophile elbow. ABHD1 plays a role in metabolizing smoking xenobiotics. ABHD2 participates in the development of atherosclerosis. ABHD4 is involved in an alternative synthesis pathway of NAE. Mutations in ABHD5 contribute to Chanarin-Dorfman syndrome. ABDH6 may play a role in nervous system metabolism and signaling. ABHD13 is a 337 amino acid single-pass membrane protein that belongs to the ABHD family.

Specifications

• Accession Number: Q7L211
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84945
• Name: Human ABHD13 (aa 235-320) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110065L07Rik; Abhd13; abhydrolase domain containing 13; abhydrolase domain-containing protein 13; AI463703; AI788994; Alpha/beta hydrolase domain-containing protein 13; bA153I24.2; BEM46L1; C13orf6; Protein ABHD13; RGD1308317; RP11-153I24.2
• Common Name: ABHD13
• Gene Symbol: ABHD13
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining