Invitrogen™ Human ABCE1 (aa 178-265) Control Fragment Recombinant Protein

Product Code. 30210805

Brand: Invitrogen™ RP104669

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111079 (PA5-111079. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action. Two transcript variants encoding the same protein have been found for this gene.

Specifications

• Accession Number: P61221
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6059
• Name: Human ABCE1 (aa 178-265) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2'-5'-oligoadenylate-binding protein; ABC 38; ABC38; ABCE 1; ABCE1; ATP binding cassette subfamily E member 1; ATP-binding cassette sub-family E member 1; ATP-binding cassette, subfamily E (OABP), member 1; ATP-binding cassette, sub-family E (OABP), member 1; ATP-binding cassette, subfamily E, member 1; C79080; HP68; HuHP68; OABP; OK/SW-cl0.40; Ribonuclease 4 inhibitor; ribonuclease L (2', 5'-oligoisoadenylate synthetase-dependent) inhibitor; ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) inhibitor; RLI; RLI1; RNase 4 inhibitor; RNase L inhibitor; RNase L inhibitor 1; RNASEL1; Rnaseli; RNS41; RNS4I; RNS4l (Eye)
• Common Name: ABCE1
• Gene Symbol: ABCE1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining