Invitrogen™ Human ABCB8 (aa 5-124) Control Fragment Recombinant Protein

Product Code. 30199498

Brand: Invitrogen™ RP91129

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60943 (PA5-60943. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This nuclear gene encodes a multi-pass membrane protein that is targeted to the mitochondrial inner membrane. The encoded protein is an ATP-dependent transporter that may mediate the passage of organic and inorganic molecules out of the mitochondria. Loss of function of the related gene in mouse results in a disruption of iron homeostasis between the mitochondria and cytosol. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q9NUT2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11194
• Name: Human ABCB8 (aa 5-124) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4833412N02Rik; AA409895; ABC transporter 8; Abcb8; ATP binding cassette subfamily B member 8; ATP-binding cassette sub-family B member 8, mitochondrial; ATP-binding cassette, subfamily B (MDR/TAP), member 8; ATP-binding cassette, sub-family B (MDR/TAP), member 8; ATP-binding cassette, sub-family B, member 8; EST328128; hypothetical protein LOC548340; MABC1; M-ABC1; mitochondrial ABC protein; mitochondrial ATP-binding cassette 1; mitochondrial potassium channel ATP-binding subunit; mitochondrial sulfonylurea-receptor; MITOSUR; zgc:113037
• Common Name: ABCB8
• Gene Symbol: ABCB8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LFRVGIRGGPFPGRLLPPLRFQTFSAVRYSDGYRSSSLLRAVAHLRSQLWAHLPRAPLAPRWSPSAWCWVGGALLGPMVLSKHPHLCLVALCEAEEAPPASSTPHVVGSRFNWKLFWQFL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining