Invitrogen™ Human ABCB4 (aa 3-53) Control Fragment Recombinant Protein

Product Code. 30207987

Brand: Invitrogen™ RP101086

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62769 (PA5-62769. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The membrane-associated protein encoded ABCB4 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This gene encodes a full transporter and member of the p-glycoprotein family of membrane proteins with phosphatidylcholine as its substrate. The function of this protein has not yet been determined; however, it may involve transport of phospholipids from liver hepatocytes into bile. Alternative splicing of this gene results in several products of undetermined function.

Specifications

• Accession Number: P21439
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5244
• Name: Human ABCB4 (aa 3-53) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ABC20; ABC21; ABCB4; ATP binding cassette subfamily B member 4; ATP-binding cassette sub-family B (MDR/TAP) member 4 (P-glycoprotein 3/ multidrug resistance 2; ATP-binding cassette sub-family B (MDR/TAP) member 4 (P-glycoprotein 3/ multidrug resistance 2); ATP-binding cassette sub-family B member 4; ATP-binding cassette, subfamily B (MDR/TAP), member 4; ATP-binding cassette, sub-family B (MDR/TAP), member 4; ATP-binding cassette, sub-family B (MDR/TAP), member 4 (P-glycoprotein 3/ multidrug resistance 2); ATP-binding cassette, subfamily B, member 4; CD243; CLCS; GBD1; GP170; ICP3; MDR1; MDR2; mdr-2; MDR2/3; MDR3; MGC163296; Multidrug resistance protein 2; multidrug resistance protein 3; multiple drug resistance 3; P glycoprotein 2; P glycoprotein 3/multiple drug resistance 3; PFIC-3; P-glycoprotein 2; P-glycoprotein 3; P-glycoprotein 3/ multidrug resistance 2; P-glycoprotein-3/multiple drug resistance-3; P-GP; Pgp3; PGY1; Pgy2; Pgy-2; Pgy3; Phosphatidylcholine translocator ABCB4
• Common Name: ABCB4
• Gene Symbol: ABCB4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining