Invitrogen™ Human ABCA9 (aa 981-1023) Control Fragment Recombinant Protein

Product Code. 30206243

Brand: Invitrogen™ RP108393

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111347 (PA5-111347. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ABCA9 (ATP-binding cassette, sub-family A (ABC1), member 9) is a 1,624 amino acid protein belonging to the ABC transporter superfamily and the ABCA family. The ABC1 subfamily is the only major ABC subfamily exclusive to multicellular eukaryotes. Ubiquitously expressed, with high expression in heart, brain and fetal tissues, ABCA9 is a multi-pass membrane protein that contains two ABC transporter domains and exists as five alternatively spliced isoforms. ABCA9 exhibits membrane subcellular localization and may play a role in monocyte differentiation and lipid homeostasis. ABCA9 is up-regulated during monocyte differentiation into macrophages and down-regulated by cholesterol loading of macrophages. Spanning 85 kb, ABCA9 contains 39 exons, with a non-coding first exon.

Specifications

• Accession Number: Q8IUA7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10350
• Name: Human ABCA9 (aa 981-1023) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ABCA9; ATP binding cassette subfamily A member 9; ATP-binding cassette A9; ATP-binding cassette sub-family A member 9; ATP-binding cassette transporter sub-family A member 9; ATP-binding cassette, subfamily A (ABC1), member 9; ATP-binding cassette, sub-family A (ABC1), member 9; D630040K07Rik; DKFZp686F2450; EST640918; MGC75415
• Common Name: ABCA9
• Gene Symbol: ABCA9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NCFPVLLDVISNGLLGIFNSSEHIQTDRSTFFEEHMDYEYGYR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining