Invitrogen™ Human ABCA1 (aa 66-215) Control Fragment Recombinant Protein

Product Code. 30198317

Brand: Invitrogen™ RP106764

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mutations in the ABCA1 gene (ATP-binding cassette transporter 1) have been reported in Tangier disease (TD). TD is an autosomal recessive disorder characterized by an absence of plasma HDL, cholesterol ester depositing in the reticulo-endothelial system and deviations in cellular lipid trafficking. ABCA1 mediates the apo-A1 associated export of cholesterol and phospholipids from the cell. It is expressed on the plasma membrane and the Golgi complex, and is regulated by cholesterol flux. Regulation of the cholesterol flux between HDL and macrophages is competitive between ABCA1 and SR-BI.

Specifications

• Accession Number: O95477
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 19
• Name: Human ABCA1 (aa 66-215) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ABC 1; ABC 1 antibody; ABC Transporter 1; Abc1; ABC-1; ABC1 antibody; Abca1; ATP binding cassette subfamily A member 1; ATP-binding cassette 1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ATP-binding cassette transporter A1; ATP-binding cassette, subfamily A (ABC1), member 1; ATP-binding cassette, sub-family A (ABC1), member 1; ATP-binding cassette, sub-family A member 1; CERP; CERP antibody; Cholesterol efflux regulatory protein; HDLDT1; membrane-bound; phospholipid-transporting ATPase ABCA1; phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; TGD
• Common Name: ABCA1
• Gene Symbol: Abca1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TLPWVQGIICNANNPCFRYPTPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining