Invitrogen™ Human AATF (aa 295-384) Control Fragment Recombinant Protein

Product Code. 30212114

Brand: Invitrogen™ RP109520

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.

Specifications

• Accession Number: Q9NY61
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26574
• Name: Human AATF (aa 295-384) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933415H02Rik; 5830465M17Rik; Aatf; apoptosis antagonizing transcription factor; apoptosis-antagonizing transcription factor; BFR2; CHE1; CHE-1; DED; HSPC277; Protein AATF; rb-binding protein Che-1; Traube protein; Trb
• Common Name: AATF
• Gene Symbol: Aatf
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining