Invitrogen™ Human AASDH (aa 440-533) Control Fragment Recombinant Protein

Product Code. 30205065

Brand: Invitrogen™ RP96699

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57674 (PA5-57674. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AASDH encodes a member of the non-ribosome peptide syntesase (NRPS) enzyme family. The encoded protein contains an AMP-binding domain, PP-binding (phosphopantetheine, or pantetheine 4'phosphate-binding) domain and the Pyrrolo-quinoline quinon (PQQ) binding domain. The protein is expressed in several adult tissues. Covalently binds beta-alanine in an ATP-dependent manner to form a thioester bond with its phosphopantetheine group and transfers it to an, as yet, unknown acceptor. May be required for a post-translational protein modification or for post-transcriptional modification of an RNA.

Specifications

• Accession Number: Q4L235
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 132949
• Name: Human AASDH (aa 440-533) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2-aminoadipic 6-semialdehyde dehydrogenase; 2-aminoadipic 6-semialdehyde dehydrogenase antibody; A230062G08Rik; A830035E16; Aasdh; AASDH antibody; ACSF4; ACSF4 antibody; acyl-CoA synthetase family member 4; acyl-CoA synthetase family member 4 antibody; aminoadipate-semialdehyde dehydrogenase; aminoadipate-semialdehyde dehydrogenase antibody; Beta-alanine-activating enzyme; HSPC318; LYS2; LYS2 antibody; non-ribosomal peptide synthetase 1098; non-ribosomal peptide synthetase 1098 antibody; non-ribosomal peptide synthetase 998; non-ribosomal peptide synthetase 998 antibody; NRPS1098; NRPS1098 antibody; NRPS998; NRPS998 antibody; Protein LYS2 homolog; Protein NRPS998; putative aminoadipate-semialdehyde dehydrogenase; RGD1311135; U26
• Common Name: AASDH
• Gene Symbol: AASDH
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LGRKDSQIKRHGKRLNIELVQQVAEELQQVESCAVTWYNQEKLILFMVSKDASVKEYIFKELQKYLPSHAVPDELVLIDSLPFTSHGKIDVSEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining