Invitrogen™ Human AAMDC (aa 60-122) Control Fragment Recombinant Protein

Product Code. 30198744

Brand: Invitrogen™ RP97280

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58165 (PA5-58165. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AAMDC (C11orf67) may play a role in preadipocyte differentiation and adipogenesis.

Specifications

• Accession Number: Q9H7C9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 28971
• Name: Human AAMDC (aa 60-122) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810020D17Rik; 1810037D19Rik; Aamdc; adipogenesis associated Mth938 domain containing; adipogenesis associated Mth938 domain-containing protein; adipogenesis associated, Mth938 domain containing; C11orf67; C29H11orf67; CK067; hypothetical protein LOC553802; LI2; Mth938 domain-containing protein; PTD015; RGD1561459; Unknown (protein for MGC:133476); UPF0366 protein C11orf67; UPF0366 protein C11orf67 homolog; zgc:112239
• Common Name: AAMDC
• Gene Symbol: AAMDC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining