Invitrogen™ Human A4GNT (aa 210-336) Control Fragment Recombinant Protein

Product Code. 30202142

Brand: Invitrogen™ RP90143

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52503 (PA5-52503. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of N-acetylglucosamine to core 2 branched O-glycans. It forms a unique glycan, GlcNAcalpha1-4Galbeta-R and is largely associated with the Golgi apparatus membrane.

Specifications

• Accession Number: Q9UNA3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51146
• Name: Human A4GNT (aa 210-336) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A4GNT; Alpha-1,4-N-acetylglucosaminyltransferase; alpha4 GnT; Alpha4GnT; AV080780; EGK_12072; Gm798; GnTalpha4; MGC149493
• Common Name: A4GNT
• Gene Symbol: A4GNT
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NFVEHYNSAIWGNQGPELMTRMLRVWCKLEDFQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAVIRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining