Invitrogen™ Human A4GALT (aa 45-145) Control Fragment Recombinant Protein

Product Code. 30196921

Brand: Invitrogen™ RP108091

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67429 (PA5-67429. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene catalyzes the transfer of galactose to lactosylceramide to form globotriaosylceramide, which has been identified as the P(k) antigen of the P blood group system. The encoded protein, which is a type II membrane protein found in the Golgi, is also required for the synthesis of the bacterial verotoxins receptor.

Specifications

• Accession Number: Q9NPC4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 53947
• Name: Human A4GALT (aa 45-145) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A14GALT; A4GALT; A4galt {ECO:0000312; A4GALT1; alpha 1,4-galactosyltransferase; alpha 14-galactosyltransferase; alpha-1,4-galactosyltransferase; Alpha-1,4-N-acetylglucosaminyltransferase; alpha4Gal-T1; cd77; CD77 synthase; Gb3; Gb3 synthase; Gb3/CD77 synthase; Gb3S; Globotriaosylceramide synthase; lac; lactosylceramide 4-alpha-galactosyltransferase; P blood group (P one antigen); P(k); P(k) antigen synthase; P1; P1/Pk. synthase; P1PK; Pk.; RGD:621583}; truncated alpha 1,4-galactosyltransferase; UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase
• Common Name: A4GALT
• Gene Symbol: A4galt
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining