Invitrogen™ Human 14-3-3 sigma (aa 44-163) Control Fragment Recombinant Protein

Product Code. 30202439

Brand: Invitrogen™ RP89532

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis.

Specifications

• Accession Number: P31947
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2810
• Name: Human 14-3-3 sigma (aa 44-163) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 14-3-3 protein sigma; 14-3-3 sigma; 14-3-3 sigma protein; 14-3-3 sigma; epithelial cell marker protein 1; Er; HGNC:10773; HME1; Mkrn3; Mme1; SFN; Stratifin; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, sigma polypeptide; Ywhas
• Common Name: 14-3-3 sigma
• Gene Symbol: SFN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining