Invitrogen™ Human 14-3-3 gamma (aa 94-161) Control Fragment Recombinant Protein

Product Code. 30209927

Brand: Invitrogen™ RP89531

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110927 (PA5-110927. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

14-3-3 gamma encodes a product that belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the rat ortholog. It is induced by growth factors in human vascular smooth muscle cells, and is also highly expressed in skeletal and heart muscles, suggesting an important role for this protein in muscle tissue. It has been shown to interact with RAF1 and protein kinase C, proteins involved in various signal transduction pathways.

Specifications

• Accession Number: P61981
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7532
• Name: Human 14-3-3 gamma (aa 94-161) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 14-3-3 gamma; 14-3-3 protein gamma; 14-3-3 protein gamma subtype; 14-3-3 protein gamma, N-terminally processed; 14-3-3 protein gamma-1; 14-3-3 protein gamma-subtype; 14-3-3 G; 14-3-3 gamma; 3-monooxgenase/tryptophan 5-monooxgenase activation protein, gamma polypeptide; 3-monooxgenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide; 3-monooxygenase/tryptophan 5-monooxgenase activation protein gamma polypeptide; 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide; 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide 1; cb47; D7Bwg1348e; fd20c02; hypothetical protein; KCIP-1; PPP1R170; Protein kinase C inhibitor protein 1; protein phosphatase 1, regulatory subunit 170; RCJMB04_5e12; tryosine 3-monooxgenase/tryptophan 5 monooxgenase activation protein gamma; tryosine 3-monooxgenase/tryptophan 5-monooxgenase activation protein gamma polypeptide; tyrosine 3/tryptophan 5 -monooxygenase activation protein gamma polypeptide; tyrosine 3/tryptophan 5 -monooxygenase activation protein, gamma polypeptide; tyrosine 3-monooxgenase/tryptophan 5-monooxgenase activation protein, gamma polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma polypeptide; wu:fd20c02; wu:fj53d01; ywhag; ywhag1; zgc:73131
• Common Name: 14-3-3 gamma
• Gene Symbol: YWHAG
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEIS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining