missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HTRA2/Omi Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £435.00
Specifications
| Antigen | HTRA2/Omi |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18234543
|
Novus Biologicals
NBP2-58890 |
100 μL |
£435.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18656166
|
Novus Biologicals
NBP2-58890-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HTRA2/Omi Polyclonal specifically detects HTRA2/Omi in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| HTRA2/Omi | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Mitochondrial Mediated Pathway | |
| High temperature requirement protein A2, HtrA serine peptidase 2, HtrA2, HtrA-like serine protease, OMIOmi stress-regulated endoprotease, PARK13EC 3.4.21.108, PRSS25serine, 25, Serine protease 25, serine protease HTRA2, mitochondrial, Serine proteinase OMI | |
| HTRA2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 27429 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title