missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HspBAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | HspBAP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
HspBAP1 Polyclonal specifically detects HspBAP1 in Human samples. It is validated for Western Blot.Specifications
| HspBAP1 | |
| Polyclonal | |
| Rabbit | |
| NP_078886 | |
| 79663 | |
| Synthetic peptide directed towards the N terminal of human HSPBAP1. Peptide sequence AAGSEATTPVIVAAGAGGEEGEHVKPFKPEKAKEIIMSLQQPAIFCNMVF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ22623, heat shock 27 kDa associated protein, HSPB (heat shock 27kD) associated protein 1, HSPB (heat shock 27kDa) associated protein 1, HSPB1-associated protein 1,27 kDa heat shock protein-associated protein 1, PASS1FLJ39386, Protein associated with small stress protein 1, protein associating with small stress protein PASS1 | |
| HSPBAP1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title