HspA4L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-57695

Product Code. 18216063

Description

HspA4L Polyclonal antibody specifically detects HspA4L in Human, Mouse samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

• Antigen: HspA4L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: APG1, APG-1, heat shock 70 kDa protein 4L, heat shock 70 kDa protein 4-like protein, heat shock 70kDa protein 4-like, Heat shock 70-related protein APG-1, heat shock protein (hsp110 family), Osmotic stress protein 94, Osp94
• Host Species: Rabbit
• Molecular Weight of Antigen: 92 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Guinea pig: 92%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%; Canine: 85%; Chicken: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunoprecipitation
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunoprecipitation
• Gene Accession No.: O95757
• Gene Symbols: HSPA4L
• Immunogen: Synthetic peptides corresponding to HSPA4L(heat shock 70kDa protein 4-like) The peptide sequence was selected from the C terminal of HSPA4L. Peptide sequence KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 22824
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only