missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HspA4L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | HspA4L |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30230355
|
Novus Biologicals
NBP3-35770-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232251
|
Novus Biologicals
NBP3-35770-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HspA4L Polyclonal antibody specifically detects HspA4L in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ImmunofluorescenceSpecifications
| HspA4L | |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| APG1, APG-1, heat shock 70 kDa protein 4L, heat shock 70 kDa protein 4-like protein, heat shock 70kDa protein 4-like, Heat shock 70-related protein APG-1, heat shock protein (hsp110 family), Osmotic stress protein 94, Osp94 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 500-600 of human HspA4L (NP_055093.2).,, Sequence:, KQNLEGDHSDAPMETETSFKNENKDNMDKMQVDQEEGHQKCHAEHTPEEEIDHTGAKTKSAVSDKQDRLNQTLKKGKVKSIDLPIQSSLCRQLGQDLLNSY | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 22824 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title