missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Hsp40/DNAJC25 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Hsp40/DNAJC25 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Hsp40/DNAJC25 Polyclonal specifically detects Hsp40/DNAJC25 in Human samples. It is validated for Western Blot.Specifications
| Hsp40/DNAJC25 | |
| Polyclonal | |
| Rabbit | |
| Q9H1X3 | |
| DNAJC25 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 548645 | |
| Synthetic peptides corresponding to Hsp40/DNAJC25 (DnaJ (Hsp40) homolog, subfamily C, member 25) The peptide sequence was selected from the middle region of Hsp40/DNAJC25. Peptide sequence RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title