missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HSP40/DNAJB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-38988-25ul
This item is not returnable.
View return policy
Description
HSP40/DNAJB1 Polyclonal specifically detects HSP40/DNAJB1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| HSP40/DNAJB1 | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| P25685 | |
| DNAJB1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDL | |
| 25 μL | |
| DNA Repair, Golgi Apparatus Markers, Membrane Trafficking and Chaperones | |
| 3337 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DnaJ (Hsp40) homolog, subfamily B, member 1, DnaJ (Hsp40) homolog, subfmaily B, member 1, dnaJ homolog subfamily B member 1, DnaJ protein homolog 1, DNAJ1, hDj-1, HDJ1, Heat shock 40 kDa protein 1, heat shock 40kD protein 1, Heat shock protein 40, HSP40, HSPF1Hdj1, Human DnaJ protein 1, radial spoke 16 homolog B, RSPH16B, Sis1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction