HSD3B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-46700

Product Code. 18672026

Description

HSD3B1 Polyclonal antibody specifically detects HSD3B1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: HSD3B1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P26439
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Gene Alias: 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1, 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I, 3BETAHSD, 3-beta-HSD I, 3-beta-hydroxy-Delta(5)-steroid dehydrogenase, 3BH, delta-5-3-ketosteroid isomerase, EC 1.1.1, HSD3B, HSDB3, HSDB3A, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1, hydroxy-delta-5-steroid dehydrogenase, 3 beta-and steroid delta-isomerase 1, I, progesterone reductase, SDR11E1, short chain dehydrogenase/reductase family 11E, member 1,3-beta-hydroxy-5-ene steroid dehydrogenase, steroid Delta-isomerase, Trophoblast antigen FDO161G
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLE
• Quantity: 0.1 mL
• Research Discipline: Cancer, Lipid and Metabolism, Prostate Cancer, Signal Transduction
• Gene ID (Entrez): 3283
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG