missing translation for 'onlineSavingsMsg'
Learn More

HSD17B7 Antibody (1G10), Novus Biologicals™

Product Code. 18365139 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18365139 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18365139 Supplier Novus Biologicals Supplier No. H00051478M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

HSD17B7 Monoclonal antibody specifically detects HSD17B7 in Human, Rat samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen HSD17B7
Applications Western Blot, ELISA, Immunocytochemistry, Sandwich ELISA
Classification Monoclonal
Clone 1G10
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_057455
Gene Alias 17 beta-hydroxysteroid dehydrogenase type VII, 17-beta-hydroxysteroid dehydrogenase 7, 3-keto-steroid reductase, EC 1.1.1.270, EC 1.1.1.62, Estradiol 17-beta-dehydrogenase 7, hydroxysteroid (17-beta) dehydrogenase 7,17beta hydroxysteroid dehydrogenase, MGC12523, MGC75018,17-beta-HSD 7, PRAP, SDR37C1, short chain dehydrogenase/reductase family 37C, member 1
Host Species Mouse
Immunogen HSD17B7 (NP_057455.1, 255 a.a. ~ 341 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQKMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCL
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 51478
Target Species Human, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.