missing translation for 'onlineSavingsMsg'
Learn More

HSD17B12 Antibody (4G11), Novus Biologicals™

Product Code. 18394239 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18394239 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18394239 Supplier Novus Biologicals Supplier No. H00051144M08

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

HSD17B12 Monoclonal antibody specifically detects HSD17B12 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen HSD17B12
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 4G11
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_057226
Gene Alias 17-beta-HSD 12, 17-beta-hydroxysteroid dehydrogenase 12, EC 1.1.1.62,3-ketoacyl-CoA reductase, EC 1.3.1.-, hydroxysteroid (17-beta) dehydrogenase 12,17beta-HSD type 12, KARestradiol 17-beta-dehydrogenase 12, SDR12C1, short chain dehydrogenase/reductase family 12C, member 1, steroid dehydrogenase homolog
Host Species Mouse
Immunogen HSD17B12 (NP_057226, 203 a.a. ~ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cell Biology, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 51144
Target Species Human, Mouse, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.