missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HSD11B2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-37954-25ul
This item is not returnable.
View return policy
Description
HSD11B2 Polyclonal specifically detects HSD11B2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| HSD11B2 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| P80365 | |
| HSD11B2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPG | |
| 25 μL | |
| Stem Cell Markers | |
| 3291 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| AME, corticosteroid 11-beta-dehydrogenase isozyme 2,11-beta-HSD2, EC 1.1.1, EC 1.1.1.-, HSD11KAME1, HSD2,11-DH2, hydroxysteroid (11-beta) dehydrogenase 2, NAD-dependent 11-beta-hydroxysteroid dehydrogenase, SDR9C3, short chain dehydrogenase/reductase family 9C member 3,11-beta-hydroxysteroid dehydrogenase type 2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction