missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HSD11B1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55319
This item is not returnable.
View return policy
Description
HSD11B1L Polyclonal specifically detects HSD11B1L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| HSD11B1L | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| 11-beta-hydroxysteroid dehydrogenase type 3, 11-DH3, EC 1.1.1, EC 1.1.1.-, HSD3,11-beta-HSD3, hydroxysteroid (11-beta) dehydrogenase 1-like, hydroxysteroid 11-beta-dehydrogenase 1-like protein, SCDR10short chain dehydrogenase/reductase 10, SDR26C2, short chain dehydrogenase/reductase family 26C, member 2, Short-chain dehydrogenase/reductase 10 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| HSD11B1L | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DYLVLNHIGGAPAGTRARSPQATRWLMQVNFVSYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYS | |
| 100 μL | |
| Lipid and Metabolism | |
| 374875 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction