missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HSCB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£309.75 - £444.15
Specifications
| Antigen | HSCB |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18251434
|
Novus Biologicals
NBP2-54997 |
100 μL |
£470.00 £444.15 / 100µL Save £25.85 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18664596
|
Novus Biologicals
NBP2-54997-25ul |
25 μL |
£328.00 £309.75 / 25µL Save £18.25 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HSCB Polyclonal specifically detects HSCB in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| HSCB | |
| Polyclonal | |
| Rabbit | |
| metabolism | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 150274 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEM | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| DnaJ homolog subfamily C member 20, DNAJC20DnaJ (Hsp40) homolog, subfamily C, member 20, Hsc20, HSC20dJ366L4.2, HscB iron-sulfur cluster co-chaperone homolog (E. coli), iron-sulfur cluster co-chaperone protein HscB, mitochondrial, Jac1, J-type co-chaperone HSC20, MGC2637, MGC74462 | |
| HSCB | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.