missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HSCB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
£196.00 - £470.00
Specifications
| Antigen | HSCB |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18410461
|
Novus Biologicals
NBP1-84066-25ul |
25 μL |
£196.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18729833
|
Novus Biologicals
NBP1-84066 |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
HSCB Polyclonal specifically detects HSCB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| HSCB | |
| Polyclonal | |
| Rabbit | |
| metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 150274 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| DnaJ homolog subfamily C member 20, DNAJC20DnaJ (Hsp40) homolog, subfamily C, member 20, Hsc20, HSC20dJ366L4.2, HscB iron-sulfur cluster co-chaperone homolog (E. coli), iron-sulfur cluster co-chaperone protein HscB, mitochondrial, Jac1, J-type co-chaperone HSC20, MGC2637, MGC74462 | |
| HSCB | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title