missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18375667

HOXD4 Antibody (1H7), Novus Biologicals™

Product Code. 18375667 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18375667 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18375667 Supplier Novus Biologicals Supplier No. H00003233M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

HOXD4 Monoclonal antibody specifically detects HOXD4 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen HOXD4
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 1H7
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_055436
Gene Alias HHO.C13, homeo box D4, homeobox D4, Homeobox protein HHO.C13, Homeobox protein Hox-4B, Homeobox protein Hox-5.1, homeobox protein Hox-D4, HOX4, Hox-4.2, Hox-4.2, mouse, homolog of homeo box X, HOX4BHOX-5.1
Host Species Mouse
Immunogen HOXD4 (NP_055436.2, 1 a.a. ~ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPF
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3233
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.