missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HOXC9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-58032-25ul
This item is not returnable.
View return policy
Description
HOXC9 Polyclonal specifically detects HOXC9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| HOXC9 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| homeobox C9, Homeobox protein Hox-3B, homeobox protein Hox-C9, HOX3, HOX3Bhomeo box C9 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 3225 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| HOXC9 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKPDAY | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction