missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18346777

Novus Biologicals™ HOXC8 Antibody (1H2), Novus Biologicals™

Product Code. 18346777 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18346777 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18346777 Supplier Novus Biologicals™ Supplier No. H00003224M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

HOXC8 Monoclonal antibody specifically detects HOXC8 in Human samples. It is validated for ELISA,Immunoprecipitation,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen HOXC8
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 1H2
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunoprecipitation
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_073149
Gene Alias homeo box C8, homeobox C8, Homeobox protein Hox-3A, homeobox protein Hox-C8, HOX3, Hox-3.1, mouse, homolog of, HOX3Ahomeo box 3A
Host Species Mouse
Immunogen HOXC8 (NP_073149, 47 a.a. ∽ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3224
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.