missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ HOXC5 Antibody (1E10), Novus Biologicals™

Product Code. 18346677 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18346677 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18346677 Supplier Novus Biologicals™ Supplier No. H00003222M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

HOXC5 Monoclonal antibody specifically detects HOXC5 in Human,Mouse samples. It is validated for Western Blot,ELISA,Immunohistochemistry,Sandwich ELISA,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen HOXC5
Applications Western Blot, ELISA, Immunohistochemistry, Sandwich ELISA, Immunocytochemistry/Immunofluorescence
Classification Monoclonal
Clone 1E10
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_061826
Gene Alias homeo box C5, homeobox C5, Homeobox protein CP11, Homeobox protein Hox-3D, homeobox protein Hox-C5, HOX3, HOX3DCP11
Host Species Mouse
Immunogen HOXC5 (NP_061826.1, 1 a.a. ∽ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPR
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3222
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.