missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18345187

Novus Biologicals™ HOXB7 Antibody (4C6), Novus Biologicals™

Product Code. 18345187 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18345187 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18345187 Supplier Novus Biologicals™ Supplier No. H00003217M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

HOXB7 Monoclonal antibody specifically detects HOXB7 in Human,Rabbit samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Functional Assay
TRUSTED_SUSTAINABILITY

Specifications

Antigen HOXB7
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Functional Assay
Classification Monoclonal
Clone 4C6
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Functional
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_004493
Gene Alias HHO.C1, homeo box 2C, homeo box B7, homeo box c1 protein, homeobox B7, Homeobox protein HHO.C1, Homeobox protein Hox-2C, homeobox protein Hox-B7, HOX2, HOX2CHox-2.3
Host Species Mouse
Immunogen HOXB7 (NP_004493, 55 a.a. ∽ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3217
Target Species Human, Rabbit
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.