missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18345187

Novus Biologicals™ HOXB7 Antibody (4C6), Novus Biologicals™

Artikelnummer. 18345187 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Quantity:
0.1 mg
Packungsgröße:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18345187 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18345187 Lieferant Novus Biologicals™ Lieferanten-Nr. H00003217M03

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Mouse Monoclonal Antibody

HOXB7 Monoclonal antibody specifically detects HOXB7 in Human,Rabbit samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Functional Assay
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen HOXB7
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Functional Assay
Classification Monoclonal
Clone 4C6
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Functional
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_004493
Gene Alias HHO.C1, homeo box 2C, homeo box B7, homeo box c1 protein, homeobox B7, Homeobox protein HHO.C1, Homeobox protein Hox-2C, homeobox protein Hox-B7, HOX2, HOX2CHox-2.3
Host Species Mouse
Immunogen HOXB7 (NP_004493, 55 a.a. ∽ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3217
Target Species Human, Rabbit
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG1 κ
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.