missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HOXB7 Antibody (4A3), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00003217-M02
This item is not returnable.
View return policy
Description
HOXB7 Monoclonal antibody specifically detects HOXB7 in Human samples. It is validated for Western Blot, ELISA, ELISA
Specifications
| HOXB7 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| HHO.C1, homeo box 2C, homeo box B7, homeo box c1 protein, homeobox B7, Homeobox protein HHO.C1, Homeobox protein Hox-2C, homeobox protein Hox-B7, HOX2, HOX2CHox-2.3 | |
| HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Sandwich ELISA | |
| 4A3 | |
| Western Blot 1:500, ELISA, Sandwich ELISA | |
| NP_004493 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 3217 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction