missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HOXB5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£359.00
Specifications
| Antigen | HOXB5 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
HOXB5 Polyclonal specifically detects HOXB5 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| HOXB5 | |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| Rabbit | |
| Human | |
| HHO.C10, homeo box 2A, homeo box B5, homeobox B5, Homeobox protein HHO.C10, Homeobox protein Hox-2A, homeobox protein Hox-B5, Homeobox protein Hu-1, Hox2.1, HOX2AHOX2, HU-1 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB5 (NP_002138). Peptide sequence MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN | |
| Affinity purified |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 3215 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title