missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. HOXB13 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

HOXB13 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Product Code. 18354727 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18354727 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18354727 Supplier Novus Biologicals Supplier No. NBP310405100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Descrizione

Rabbit Polyclonal Antibody

HOXB13 Polyclonal specifically detects HOXB13 in Mouse samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifica

Antigen HOXB13
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias homeo box B13, homeobox B13, homeobox protein Hox-B13, PSGD
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the n terminal region of mouse HOXB13 (NP_032293). Peptide sequence MEPGNYATLDGAKDIEGLLGAGGGRNLVSHSSPLASHPAAPTLMPTVNYA
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10481
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.